PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB0093G10070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 294aa    MW: 32184.4 Da    PI: 8.4984
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB0093G10070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.71.3e-082360140
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                     r rW+ eE++++++a  ++G + Wk+I   +  ++t+ q+
   OB0093G10070.1 23 RERWSGEEHDRFLHALMLFGRD-WKRIEGFVA-TKTATQV 60
                     78******************77.*******99.9999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.87E-91262IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-72260IPR006447Myb domain, plants
PfamPF002492.8E-62360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-52360IPR009057Homeodomain-like
CDDcd001679.60E-52560No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MAAMAAPVLG KKTRKPYTIT RPRERWSGEE HDRFLHALML FGRDWKRIEG FVATKTATQV  60
PIDFIHPCVL LALCCKINGG FRIGDRVGFL NSRVSLCKPL IDLPWFIMQI RSHAQKHFLK  120
ARKFGLAGGL PPPPLHPRRA ALLPAKAVTA DTISPWTPSA IAPPPWPPAG GAPPSSAVQR  180
SMSDWSPACY APEDPFRPLI HADDCSFIEA PNCSGSGEAW IADAAFLPDE TILLPISPDD  240
LGFAQVYKFV GDLFGSGEPR PVEAQLRRLQ AMDPAISETI LLVLRNLEAN LLSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1241447e-44AC124144.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0099P06, complete sequence.
GenBankAP0149617e-44AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126137e-44CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664992.11e-140PREDICTED: protein REVEILLE 6-like
TrEMBLJ3KUZ40.0J3KUZ4_ORYBR; Uncharacterized protein
STRINGOB0093G10070.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.15e-18MYB_related family protein